Protein Info for IAI46_13475 in Serratia liquefaciens MT49

Annotation: TIGR01620 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 71 to 89 (19 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details TIGR01620: TIGR01620 family protein" amino acids 57 to 342 (286 residues), 452.8 bits, see alignment E=2.3e-140 PF05128: DUF697" amino acids 184 to 342 (159 residues), 188.9 bits, see alignment E=2.8e-60

Best Hits

Swiss-Prot: 98% identical to Y2618_SERP5: UPF0283 membrane protein Spro_2618 (Spro_2618) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 97% identity to srr:SerAS9_2614)

Predicted SEED Role

"Membrane protein YcjF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>IAI46_13475 TIGR01620 family protein (Serratia liquefaciens MT49)
MSEPIKPRIDFEQPLQPPQEPVLRANVAFDEQQAESFFPAAPELQQEDEEGRAEGIINAA
LKPKRSLWRKMVTAGLALFGVSVVAQGVQWVHTAWVQQDWIAMGGGVAGGLIVFAGVGSV
VTEWRRLYRLRQRAEERDVARELLHSHGLGKGREFCEKLARQAGLDQGHPALQRWQASLH
ETQNDREVVALYAKLVQPVLDNQARREISRSAAESTLMIAVSPLALVDMAFIAWRNIRLI
NRIAALYGIELGYFSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSARAAQGI
GAGLLTARLGIKAMELCRPLPWLEGEKPKLGDFRSQLVGQLKETMKKGDSKAK