Protein Info for IAI46_13385 in Serratia liquefaciens MT49

Annotation: efflux RND transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1061 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 342 to 361 (20 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details amino acids 439 to 460 (22 residues), see Phobius details amino acids 471 to 498 (28 residues), see Phobius details amino acids 544 to 564 (21 residues), see Phobius details amino acids 879 to 896 (18 residues), see Phobius details amino acids 903 to 926 (24 residues), see Phobius details amino acids 932 to 953 (22 residues), see Phobius details amino acids 981 to 1002 (22 residues), see Phobius details amino acids 1009 to 1035 (27 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 4 to 1049 (1046 residues), 1159.2 bits, see alignment E=0 PF00873: ACR_tran" amino acids 4 to 1035 (1032 residues), 1174 bits, see alignment E=0 PF03176: MMPL" amino acids 302 to 533 (232 residues), 48 bits, see alignment E=1.3e-16 PF02355: SecD_SecF" amino acids 335 to 494 (160 residues), 26.1 bits, see alignment E=8.2e-10

Best Hits

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 62% identity to aav:Aave_1363)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1061 amino acids)

>IAI46_13385 efflux RND transporter permease subunit (Serratia liquefaciens MT49)
MTFPRFFIARPIFAIVLSILMVLAGGVAFFQLPLSEYPAVTPPTVQVTASYPGANPKVIA
ETVAAPLEQAITGVEGMLYMSSQSATDGRMILTVTFAQGTNADMAQVQVQNRVSRALPRL
PEEVQRQGVVTQKTSPDILMVVHLLSPDQRYDPLYISNYAYLQVRDELSRIPGVSDVLVW
GAGEYSMRLWLDPDLIAARGLTAGDVIAAVREQNVQVAAGSVGQTPNSNAAFQVTVNTLG
RLTDEEQFGDIIIRTGSDGQITRLRDVARIEMGADAYALRSLLDGEPAVALQIIQSPGAN
ALDVSKAVRATMQRLETHFPAGLTSRIAYDPTVFVSASLESVATTLLEAILLVVIVVVLF
LHNWRASLIPLMAVPVSLIGTFAVMHLMGFSLNTLSLFGLVLSIGIVVDDAIVVVENVER
HIGNGEEPPQAARRAMDEVTGPIIAITSVLAAVFIPTAFLSGLQGEFYQQFALTIAISTI
LSAINSLTLSPALAGLLLRPRKAANARDPRTLRGRADRLFRAFGRPFRHAPSAYGNTVRK
VVRVSGLALLVYGGLLALTFFGFKAVPPGFVPMQDKYYLVGIAQLPNSASLERTDAVVKQ
MSKIALAEPGVESVVAFPGLSINGFVNVPNAAVMFVMLDPFEARTTDDLSATAIAGRLQA
KFAGIPDGFLGVFPPPPVPGLGATGGFKMQIEDRSGAGLDALVQQTQILMTKATESGQVA
GLMTSFDVNAPQLDVAIDRTKAMSQGVRLADIFESLQVYLGSLYVNDFNRFGRTYKVTAQ
ADADHRMQAEAIGRLQVRNAAGKMLPLSSFVTVTPSSGPDRVIHYNGYPSADISGGAMAG
ISSGQAVAVMERLAKEVLPEGMTFEWTDLTYQQKLAGDSALFIFPLCVLLAYLILAAQYN
SWLLPLAVLLIVPMCLLSAIIGVWMTGGDNNVFVQIGLIVLVGLAAKNAILIVEFARTLE
AEGASALDAVIEACRLRLRPILMTSLAFIAGVVPLVFAGGAGAEMRHAMGIAVFAGMLGV
TLFGLFLTPVFYVVMRNLAVRIERRRAESRLRKQRIKESTS