Protein Info for IAI46_13380 in Serratia liquefaciens MT49

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 364 (328 residues), 276.5 bits, see alignment E=1.3e-86 PF16576: HlyD_D23" amino acids 61 to 286 (226 residues), 67.5 bits, see alignment E=1.7e-22 PF13533: Biotin_lipoyl_2" amino acids 62 to 109 (48 residues), 33.5 bits, see alignment 4.1e-12 PF13437: HlyD_3" amino acids 173 to 283 (111 residues), 36.7 bits, see alignment E=9e-13

Best Hits

Swiss-Prot: 34% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 71% identity to pap:PSPA7_1624)

MetaCyc: 34% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>IAI46_13380 efflux RND transporter periplasmic adaptor subunit (Serratia liquefaciens MT49)
MKAKRVTLITAAISVAFAVAGCKETVSAAAPAKPPSVPVAEVVVRPVTPFVEFTGSLTAV
KQVELRPRVAGYLQDVSVPEGRWVEKGQRLFLIDSRVYEAALSAAKARLREAEAAARLAQ
TEYARATQLFAQKVFARAQLDTATASLNAGKAQVDAAKAALAAAELDMEFTRVTAPISGR
VGQVLVTEGNYVTNGVTPLTTIVSTNPLQVYFDVDERTYLRSLATDLTRATPPATKVMVA
LITDKTYTRTGRVDFLANSADRGTGTVRIRAVVDNADGQLTPGLFAKVKLETGAPRARVL
VSDQSIGTDQGRRYVLVVGKGDKTEYRPVELGPMVEGMRVIEQGLQPGERIVVKGLVRPG
MQITPQTTAIDGAPMTAPTTTGAA