Protein Info for IAI46_13265 in Serratia liquefaciens MT49

Annotation: universal stress protein UspE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00582: Usp
  • amino acids 4 to 146 (143 residues), 78.5 bits, E=3.9e-26
  • amino acids 175 to 300 (126 residues), 56.2 bits, E=2.8e-19

Best Hits

Swiss-Prot: 84% identical to USPE_YERPE: Universal stress protein E (uspE) from Yersinia pestis

KEGG orthology group: K14055, universal stress protein E (inferred from 98% identity to srs:SerAS12_2578)

Predicted SEED Role

"Universal stress protein E" in subsystem Universal stress protein family

Protein Sequence (320 amino acids)

>IAI46_13265 universal stress protein UspE (Serratia liquefaciens MT49)
MAKYQNLLVAIDPNQDDQPALRRAVYLIKRNGGRIKAFLPIYDFSYEMTTLLSPDERTAM
RQGVISQRAAWITEQCRFYLDEGVPIEIKVVWHNRPYEAIIQEVIAGKHDLLLKMAHQHD
RLESVIFTPTDWHLLRKCPCPVWMVKDQPWPEGSKAVVAVNLASEEPYHDPLNIKLVQET
VELAHNVNQTEVHLVGAYPVTPINIAIELPDFDPSVYNDAIRGQHLIAMKALRQKFGINE
EFTHVEKGLPEEVIPDLAEHLQAGVVVLGTLGRTGISAAFIGNTAEHVIDHLKCDLLVIK
PENFNCPIEVDEDDEHDDED