Protein Info for IAI46_13235 in Serratia liquefaciens MT49

Annotation: tagatose bisphosphate family class II aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 1 to 282 (282 residues), 336.5 bits, E=1.4e-104
• TIGR01858: class II aldolase, tagatose bisphosphate family
  • amino acids 3 to 282 (280 residues), 485.3 bits, E=4.9e-150
• PF01116: F_bP_aldolase
  • amino acids 6 to 282 (277 residues), 342.1 bits, E=1.4e-106

Best Hits

Swiss-Prot: 69% identical to GATY_KLEP7: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K08302, tagatose 1,6-diphosphate aldolase [EC: 4.1.2.40] (inferred from 99% identity to spe:Spro_2579)

MetaCyc: 61% identical to tagatose-1,6-bisphosphate aldolase 2 (Escherichia coli K-12 substr. MG1655)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

"Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40)" in subsystem D-Tagatose and Galactitol Utilization or Lactose and Galactose Uptake and Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 4.1.2.40)

MetaCyc Pathways

• superpathway of hexitol degradation (bacteria) (16/18 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
• N-acetyl-D-galactosamine degradation (3/5 steps found)
• galactitol degradation (3/5 steps found)
• D-tagatose degradation (1/3 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Galactose metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.40

Use Curated BLAST to search for 4.1.2.40

Protein Sequence (284 amino acids)

>IAI46_13235 tagatose bisphosphate family class II aldolase (Serratia liquefaciens MT49)
MYLISNREMLQKAQRQGYAVPAFNVHNLETVQVVAETAAELRSPVIMAGTPGTFSYAGTD
YLIGICQAAARRYDLPLALHLDHHEEMDDIEYKVKSGIRSVMIDGSHLPFEQNIAKVAEA
VALCHRYGGSVEAELGRLGGQEDDLIVDSTDSFFTDPAAAREFVTATGIDSLAVAIGSAH
GLYHGEPKLDFDRLALIREQVDIPLVLHGASGIPEAMVKRAISLGVCKVNVATELKIAFA
DAVKSYFSQHPDANDPRKYIVPGKLAMKEVVAEKIRICGSSGML