Protein Info for IAI46_13205 in Serratia liquefaciens MT49

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 264 (182 residues), 58.5 bits, see alignment E=3.9e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 99% identity to spe:Spro_2573)

MetaCyc: 31% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>IAI46_13205 carbohydrate ABC transporter permease (Serratia liquefaciens MT49)
MSISKRTLVYLFMVLAALASVVPFIWMLVTSLKTQAESIQIPLTLLPAHPSLQAYGKIMR
EIPFADFYLNSLLATFFTVTLQMVIATMAAYGFSRLHFRGRDAVFLVCISILMVPGQAFL
IPQFLVVQKLGLVNSITGLVLPGIFSIYATFLLRQFFLAVPKEMEEAALIDGYSYFAIFW
RIMLPLIRPGIIACIIINGLWSWNNLMWPLIVNTTTEKLTLPVGLASLSSRAGVEYPLLM
AGALMAVIPMLMLFILFQRYFIQGIASAGVKG