Protein Info for IAI46_13170 in Serratia liquefaciens MT49

Annotation: pyridoxal kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 13 to 272 (260 residues), 148.7 bits, E=1.2e-47
• PF08543: Phos_pyr_kin
  • amino acids 86 to 262 (177 residues), 83.2 bits, E=2e-27
• PF00294: PfkB
  • amino acids 131 to 250 (120 residues), 45.5 bits, E=6.5e-16

Best Hits

Swiss-Prot: 46% identical to PDXK_CUPMC: Pyridoxine/pyridoxal/pyridoxamine kinase (pdxK) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 88% identity to spe:Spro_2566)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (7/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.35

Use Curated BLAST to search for 2.7.1.35

Protein Sequence (279 amino acids)

>IAI46_13170 pyridoxal kinase (Serratia liquefaciens MT49)
MQQISQLQPPQIDVISIQSQVVYGSVGNGIAYRTLLKKGLEVLQVPSVLFGCPPYYGAPS
GGVISAEWFGGFLADLLARGVMNRTRAVIVGYLGNVDQCHILDTWLQRVRAINPQIKIYI
DPVMGDYGEGVYVDKRIVDCYRSPFLKLANGLTPNGFELEQLCGHPLTTQEQTRQAAQAL
LNDTTEWVLVTSAPGVAENDDQLGLLLVKHDEVQSYTHPRIQSKVKGTGDMFAALLVSHL
LHGKSLDEAIVTAGGEVCDVLAEAEHFGLEEIGSLRALK