Protein Info for IAI46_13155 in Serratia liquefaciens MT49

Annotation: aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00392: GntR" amino acids 12 to 73 (62 residues), 57.9 bits, see alignment E=6.3e-20 PF00155: Aminotran_1_2" amino acids 149 to 422 (274 residues), 70.6 bits, see alignment E=1.5e-23

Best Hits

KEGG orthology group: None (inferred from 88% identity to spe:Spro_2563)

Predicted SEED Role

"Predicted transcriptional regulator of pyridoxine metabolism" in subsystem Pyridoxin (Vitamin B6) Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>IAI46_13155 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme (Serratia liquefaciens MT49)
MSSLYAKGGSAVQIAEQISTQIKQGDLQPGDLLPPVRQLAGELGVNPNTVASAYAKLRDA
GLVATRGRAGTQVLEQPLMTVRNVRQVPEGMGDLASGNLDAALLPALSLGAEDVFPQQTG
YDVSGDLPALCRLAGDWLSQQGAELGEPAVFSGALDAIEKALRIHAAPGASVWVEDPCWP
PLLTLLRHLRLKPLPLPVDEQGCRLPEKEAAPLGAAVILTPRAQNPTGMSLSAGRAASWR
EFLSQNPGCLAIVDDFWGPLSQRPLHLPFTADNGLYVLSLSKFLSPDLRIALACGKPQLL
QTMRADQYIRERWVSHILQQIAVKLWTQAQQEGLFARAQQTYQQRRDDLSERLRALTGVP
VSPGEGVHIWLPVRSEAAASQMMAQRGWLVQSGEPFRLKSGPAIRISLANLEPAQLETLA
QDLAVAIGTGTVVN