Protein Info for IAI46_13135 in Serratia liquefaciens MT49

Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 175 to 188 (14 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 420 to 440 (21 residues), see Phobius details amino acids 480 to 480 (1 residues), see Phobius details amino acids 511 to 533 (23 residues), see Phobius details PF01384: PHO4" amino acids 81 to 526 (446 residues), 307.3 bits, see alignment E=6.6e-96

Best Hits

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_2563)

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>IAI46_13135 inorganic phosphate transporter (Serratia liquefaciens MT49)
MSDNSAVQAGAPSASSLPKIYQKNSRLTVLFFILLLVLGIAFAGVNLFNDVSDAGAVYTS
YVPFLLLGMALLIALGFEFVNGFHDTANAVATVIYTHSLSPMVAVVWSGFFNFLGVLLSS
GVVAFGIISLLPVELILQAGTGNGFAMVYALLFSAIIWNLGTWWLGLPASSSHTLIGSII
GVGVANALIHGRTGTSGVDWGQAIKVGYALLLSPVIGFVFAALLLLALKVFVKNRQLYTA
PKNDSPPPLWIRSLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTMPIAYALNRSMPPEQ
IPRVAALAEVTKNQLLQQFPAVSQVPAREVLTGYVRTSELTPEVVPALAQLTGAIGDQIR
QYGSVDKIPAQAVSNTRNDMYLTSEVIKHLKTEKQPQIPADSQRNLDALKGELDSATRFI
PFWVKVVVAIALGLGTMVGWRRIVVTVGEKIGKSHLTYAQGASAELVAMTTIGAADAFGL
PVSTTHVLSSGIAGTMAANRSGLQMSTLRNLLMAWVLTLPASVLLSAGLYWIFTHF