Protein Info for IAI46_13075 in Serratia liquefaciens MT49

Annotation: KUP/HAK/KT family potassium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details amino acids 426 to 444 (19 residues), see Phobius details PF02705: K_trans" amino acids 21 to 547 (527 residues), 682.8 bits, see alignment E=1.6e-209

Best Hits

Swiss-Prot: 61% identical to KUP1_BRASO: Probable potassium transport system protein kup 1 (kup1) from Bradyrhizobium sp. (strain ORS 278)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 93% identity to spe:Spro_2547)

MetaCyc: 45% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (626 amino acids)

>IAI46_13075 KUP/HAK/KT family potassium transporter (Serratia liquefaciens MT49)
MSTGNEQEQTPKISMPLLAGGALGVVFGDIGTSPLYTLKTVLYLSGDAPSAPVILGLLSL
IFWTLVIVTSLKYAMFAMRIDNRGEGGIMALMSLLVSKKKARPMVLFAGLFGAALIYGDG
AITPAISVLSALEGLNIVLPESKPYILPAAVLILVSLFAIQPLGTARIGKVFGPIMALWF
FSIAVLGIWGIVQHPAVLMALNPLYGIHFLFSNGLTSFLVLGGVFLCVTGAEALYADMGH
FGKKPIWLAWFGIVFPSLLLNYAGQAALILSGADVTQNIFFRLCPPMLQIPLVILATLAT
IIASQAIISGAFSMTRQAIQLGWLPRLRVKQTTEESYGQIYIGAINWLLMAVTVFLTVFF
KSSDNLAAAYGIAVSLTMIMTTGLLFVAMREVWRWGTLASLLVAGGFFIVDLSFLLANLS
KVMQGGYVPLLMATLVYGVMLIWHRGVLAASRTLGEKNLPLADFLAHLEERNIPRVPGTA
IFLTRTLNGTPPVMRWQVKRNGSLHANVLALHIMIVNEPRVANAERLVMRQQSPGFWCAV
ASYGFMERPNIPRLLQHAEAQKTGLNFDDATYYLGHESVVRREARDRLPAWQRNIFALMV
RNGMHVTDYYYLPSDQVVEISRRVPV