Protein Info for IAI46_13020 in Serratia liquefaciens MT49

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 327 to 353 (27 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details amino acids 496 to 518 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 343 to 524 (182 residues), 75.4 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 90% identical to FBPB_SERMA: Fe(3+)-transport system permease protein SfuB (fbpB) from Serratia marcescens

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 95% identity to spe:Spro_2535)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>IAI46_13020 iron ABC transporter permease (Serratia liquefaciens MT49)
MSNIGFNAAGAAPRYASARRHQRPGLFIVAVAILLSLLALLPLGFVISVAFETGWPTVKA
LVFRPRVAELLLNTLLLVVFTLPICAVLGVALAWLTERTTLPGRRIWSLLATAPLAVPAF
VQSYAWISLVPSMHGLGAGVFISVIAYFPFIYLPAAAVLRRLDPGIEDVATSLGTRPLAV
FFRVVLPQLKLAIWGGSLLIALHLLAEYGLYAMIRFDTFTTAIFDQFQSTFNGPAANMLA
GVLVLCCLVLLLLEAGSRGRARYARVGSGSARSQNAYRLGPAATLFGLLLPLVLTALALG
VPFITLARWLTLGGFEVWRNTELLPALLQTLSLAASGALLITLCAIPMAWLSVRYPARLY
RILEGCNYVTSSLPGIVVALALVTITIHSFRPIYQTEITLLLAYLLMFMPRALINLRAGI
AQAPVELENVARSLGRSPAQALWSTTLRLAAPGAAAGAALVFLAISNELTATLLLAPNGT
RTLATAFWALTSEIDYVAAAPYALIMVVLSLPLTWLLYSQSKRTAGL