Protein Info for IAI46_13005 in Serratia liquefaciens MT49

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 176 to 195 (20 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details PF00571: CBS" amino acids 24 to 80 (57 residues), 17.4 bits, see alignment E=4.6e-07 amino acids 93 to 142 (50 residues), 21.1 bits, see alignment 3.3e-08 PF01769: MgtE" amino acids 209 to 331 (123 residues), 109.4 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 96% identity to spe:Spro_2531)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>IAI46_13005 magnesium transporter (Serratia liquefaciens MT49)
MKSHQNYLSPALAHAETQDESSIASYMNADFITVPGNMTVNKAKEYFLSQLKTDEIPAQL
FVTADDYHLRGTLSVKKLLQCEDDDKPVGVMINHSYFQVSPDDDRNDVAHLLGKGGLDVV
PVVVNKTLVGVLGEKEIARLIEDENTEDAQRQGASLPLDKPYLETSPWALWRKRSVWLLM
LFVAEAYTGNVLKAFEEQLEAAIALAFFIPLLIGTGGNSGTQITSTLVRAMALGEVSLRN
LGAVIRKEVSTSLLIAATIGIAAWARAWIMGVGMDVTMVVSLSLVAITVWSAIVSSIIPM
LLKRVGIDPAVVSAPFIATFIDGTGLIIYFKIAQHVLGI