Protein Info for IAI46_12990 in Serratia liquefaciens MT49

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 8 to 279 (272 residues), 208.4 bits, see alignment E=6.8e-66 PF01545: Cation_efflux" amino acids 12 to 203 (192 residues), 166.8 bits, see alignment E=5.2e-53 PF16916: ZT_dimer" amino acids 211 to 280 (70 residues), 36.1 bits, see alignment E=5.6e-13 amino acids 287 to 361 (75 residues), 37.9 bits, see alignment E=1.6e-13 amino acids 376 to 453 (78 residues), 50.8 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 95% identity to spe:Spro_2530)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>IAI46_12990 cation diffusion facilitator family transporter (Serratia liquefaciens MT49)
MQNEKQSVARNSMIASGLLATGKFIAGIFTGSIGLISEGIHSFTDFIATSITWLAVRISD
KPADDDHHFGHGKVENLAALFEVLLLLGAAGWIVYEAGKSLLGEAHEIVAAPVVIAVLLI
SIVVDFFRVRALNRVAKATDSAALEADALHFFSDMLASAVVLLGMVFVMLGFNRADAIAA
LIVACFIVVAAVKLGKRSFDSLMDTAPAGAKEEIDALLQSFPAILATENIRIRNAGAMLF
IEVTVAVCRTLPLERINALKKSIAERLERQYANAEATVIANPQTRSDEDMATRIRVIAAN
HGAVVQNLALQQLPERMSISLDLAVPASASVAQAHDIASEIETLLREAIGEETEIETHLE
PQTHHWIASEDVAPEELAHIRQILHVAVENGEMVQDVHNIRARKTANGIIVNFHCRVSPA
ASIVSAHAAVDSIERQLRALYPSISRAVGHVEPIKPKPGI