Protein Info for IAI46_12935 in Serratia liquefaciens MT49

Annotation: alpha-glucosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF02056: Glyco_hydro_4" amino acids 4 to 185 (182 residues), 155.7 bits, see alignment E=1e-49 PF11975: Glyco_hydro_4C" amino acids 197 to 425 (229 residues), 99.3 bits, see alignment E=3.2e-32

Best Hits

Swiss-Prot: 90% identical to PALH_ERWRD: Alpha-glucosidase (palH) from Erwinia rhapontici

KEGG orthology group: K07406, alpha-galactosidase [EC: 3.2.1.22] (inferred from 98% identity to spe:Spro_2523)

Predicted SEED Role

"Alpha-galactosidase (EC 3.2.1.22)" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Galactosylceramide and Sulfatide metabolism or Lactose and Galactose Uptake and Utilization or Melibiose Utilization (EC 3.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.22

Use Curated BLAST to search for 3.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>IAI46_12935 alpha-glucosidase (Serratia liquefaciens MT49)
MATKIVLVGAGSAQFGYGTLGDIFQSKTLYGSEIVLHDINPSALAVTEKTARDFLAAEDL
PFTVSATTDRKTALKGAEFVIISIEVGDRFALWDLDWQIPQQYGIQQVYGENGGPGGLFH
SLRIIPPILDICADVADICPNAWIFNYSNPMSRICTTVHRRFPQLNFVGMCHEIASLERY
LPEMLGTSFENLNLRAAGLNHFSVLLEASYKDSGKDAYGDVRAKAPDYFSRLPGYSDILA
YTRTHGKLVQTEGSTERDALGGKDSAYPWADRTLFKEILEKFHHLPITGDSHFGEYIRWA
SEVSDHRGILDFYTFYRNYLGHVQPKIELKLKERVVPIMEGILTDSGYEESAVNIPNLGF
IKQLPDFIAVEVPAIIDRKGVHGIKVDMPAGIGGLLSNQIAIHDLTADAVIEGSRDLVIQ
ALLVDSVNDKCRAIPELVDVMISRQSPWLDYLK