Protein Info for IAI46_12905 in Serratia liquefaciens MT49

Annotation: D-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR02035: D-serine ammonia-lyase" amino acids 10 to 438 (429 residues), 713.8 bits, see alignment E=3.6e-219 PF00291: PALP" amino acids 96 to 394 (299 residues), 138.6 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 92% identical to SDHD_SERP5: D-serine dehydratase (dsdA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01753, D-serine dehydratase [EC: 4.3.1.18] (inferred from 92% identity to spe:Spro_2515)

MetaCyc: 73% identical to D-serine ammonia-lyase (Escherichia coli K-12 substr. MG1655)
D-serine ammonia-lyase. [EC: 4.3.1.18]

Predicted SEED Role

"D-serine dehydratase (EC 4.3.1.18)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>IAI46_12905 D-serine ammonia-lyase (Serratia liquefaciens MT49)
MEKTQIQQLVTQFPLVQELIDLKPVTWFNPQATTLQVGLPHVGLGAEDVAEAEQRLARFA
PYLSVAFPETQATKGVIESEVVALPAMQTALNQRYGLTLGGRLLLKKDSHLPISGSIKAR
GGIYEVLAHAEKLALKAGLLHLTDDYAKLFSPEFREFFGGYRIAVGSTGNLGMSIGIISA
RLGFSVSVHMSADAREWKKQKLRDNGVNVVEYEQDYGVAVEQGRLQAASDPRCFFIDDEN
SQTLFLGYAVAGGRLKRQFAESGIRVDAQHPLFVYLPCGVGGGPGGVAFGLKLAFGDHVR
CIFAEPTHSPCMLLGVHTGLHDGISVQDLGIDNQTAADGLAVGRASGFVGRAMERLLAGF
YTLSDVEMFALLGLLDRHEHIRLEPSALAGMPGPWRVAADAEWLASQGLNEEQMNHATHL
VWATGGGMVPEAEMAKYLAAAQQSL