Protein Info for IAI46_12900 in Serratia liquefaciens MT49

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02431: beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family
  • amino acids 29 to 273 (245 residues), 314.4 bits, E=2.4e-98
• PF09339: HTH_IclR
  • amino acids 34 to 83 (50 residues), 53.3 bits, 1.9e-18
• PF01614: IclR
  • amino acids 149 to 273 (125 residues), 109.3 bits, E=1.3e-35

Best Hits

Swiss-Prot: 53% identical to PCAR_PSEPU: Pca regulon regulatory protein (pcaR) from Pseudomonas putida

KEGG orthology group: K02624, IclR family transcriptional regulator, pca regulon regulatory protein (inferred from 92% identity to srs:SerAS12_2499)

Predicted SEED Role

"Pca regulon regulatory protein PcaR" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Protein Sequence (277 amino acids)

>IAI46_12900 helix-turn-helix domain-containing protein (Serratia liquefaciens MT49)
MTKTAGGEEISAPDALLSPASGDPFKGDPNFMASLARGLEVIQAFTPQRRLMSISQISQK
TGIPRAAVRRCLYTLNKLGFVYAQDGKNFELRPRILTLAHAYLGATPLAKATQPVLKHIS
QLLNESCSIATLDGDNILYIARASAERIMTIDLNIGSRLPAFATSMGRVLLSHLPPDKLD
DYLQRISLVRYTQYTIGSIDKLRDELDKVRAQGYAINDQELEIGLRSIAVPIASMDGRVT
AALNVGVQAGHVPLSELTDRILPILLEGAQELSLLSH