Protein Info for IAI46_12880 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details TIGR00895: MFS transporter, aromatic acid:H+ symporter (AAHS) family" amino acids 9 to 407 (399 residues), 446 bits, see alignment E=6e-138 PF00083: Sugar_tr" amino acids 27 to 275 (249 residues), 87.6 bits, see alignment E=1.8e-28 PF07690: MFS_1" amino acids 30 to 285 (256 residues), 132.7 bits, see alignment E=3.1e-42 amino acids 263 to 432 (170 residues), 77.4 bits, see alignment E=2e-25 PF06779: MFS_4" amino acids 50 to 203 (154 residues), 33.7 bits, see alignment E=5.3e-12

Best Hits

Swiss-Prot: 58% identical to PCAK_PSEPU: 4-hydroxybenzoate transporter PcaK (pcaK) from Pseudomonas putida

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 95% identity to spe:Spro_2507)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>IAI46_12880 MFS transporter (Serratia liquefaciens MT49)
MSQPNTLEIQSFINENPFSRYQWLILVLCFLTVALDGFDTAIIGFIATSLVQDWGIEKTS
LGPVMSAALVGLAVGALTAGPLADRIGRKKVLVLSLILFGGFSLLTAFATTLPMLTLLRF
LTGLGLGAAMPNAATLMSEYAPERKRALLVNLMFCGFPLGSSMGGFVSAWLIPHFGWQSV
MVLGGVMPLLLAVVLIVALPESARFMVVRGYPAQRIAAVLKRIAPLNLAEPLHFSLSEDG
QVKNKSALGVIFSPRYLLGTLMLCLTYFMGLMIFYLLTSWLPLLIRETGASIRQASLITA
LFPLGGGIGVLIIGWLMDRMNPHKVVAVGYLLTGVFVCAIGYVYTDPLLMAVTVFIAGTC
MNGAQSSMPALAAGFYPTQGRATGVAWMLGLGRFGGILGAMSGGVLMQMQLSFSTIFTLL
AIPALVAALALVAKHFSSKAAALPGSLNKAL