Protein Info for IAI46_12860 in Serratia liquefaciens MT49

Annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase
  • amino acids 5 to 611 (607 residues), 819.5 bits, E=1e-250
• PF02776: TPP_enzyme_N
  • amino acids 7 to 132 (126 residues), 55.3 bits, E=8.8e-19
• PF00205: TPP_enzyme_M
  • amino acids 220 to 349 (130 residues), 126.3 bits, E=1.1e-40
• PF02775: TPP_enzyme_C
  • amino acids 424 to 568 (145 residues), 91.2 bits, E=8.7e-30

Best Hits

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 84% identity to pao:Pat9b_4546)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

• myo-inositol degradation I (6/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (6/10 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Protein Sequence (614 amino acids)

>IAI46_12860 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing) (Serratia liquefaciens MT49)
MAKIRCTAAQAVVRYLSNQFTEIEGERVPLFPGVYGIFGHGNVTCLGEALEAVQDILPTW
RGQNEQSMGFAAIGFAKAMVRRQIMVVTASIGPGTANLLTAAGVAHTSRLPMLMICGDSF
ARRHPDPVMQQIEHFNDPTQTINDAFKTVSRYWDRITYPEQIMSSLPQAVATMLDPGDCG
PAFIGMCQDVQEMAWDYPEAFFAPQLHLMPRPRPDRLQLAHAAQCLMNAKRPLIISGGGV
RYSQAEAELEAFAVRHGIPVVETIAGKGAFTHDHPIHMGPIGILGSTSANELASRADVVV
AIGTRLMDFVTGSWTVFDQQAQFISLNAARFDAHKHRAIPLVCDAREGILELNHALGEWV
AAPAWLAKGRAAFADWNALIAKTQEPGVTADVPSYAQVIGVVNTVAAPEDYIISAAGGLP
GELVKGWRVKDPGTFDCEFGFSCMGYELSAGWGAAMAGKKQDVFVMIGDGTYMMMNSDIY
SSVLSGHKFILLVCDNGGYAVINRLQNAKGGASFNNLLKDCRVKEPFPVDFVANAESMGA
YARKVTSLEQLEDALKWAKGNDRTTVISIATDAHHWTPGDAWWDVGVPEVSERESVNQAH
REHLEGRKNQRIGI