Protein Info for IAI46_12785 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 10 to 30 (21 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 263 (246 residues), 163.7 bits, see alignment E=8.9e-52 amino acids 240 to 412 (173 residues), 52.6 bits, see alignment E=5.4e-18 PF13347: MFS_2" amino acids 211 to 356 (146 residues), 39.9 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to srs:SerAS12_2481)

Predicted SEED Role

"Putative 2-ketogluconate transporter, ACS family-MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>IAI46_12785 MFS transporter (Serratia liquefaciens MT49)
MDNKIPNTRWLRVIAPILIACIISFMDRVNISFALPGGMESDLGITSQMAGLASGIFFIG
YLFLQVPGGRIAVNGSGKRFIAWSLCAWAVVSVATGFVTNHYQLLVLRFVLGISEGGMLP
VVLTMISNWFPEKELGRANAFVMMFAPLGGMLTAPISGAIINAFDWRWLFIIEGLLSLVV
LAVWWLLISDRPQEARWLPARERDYLITELTRERQERSKLQPVSKAPLRDVFRNKGLMKL
VLLNFFYQTGDYGYTLWLPTILKNLTGGNMASVGFLAILPFVATLLGIYLISVLTDKTGK
RRLWVMVSLFCFAAALLASVVLRHNVVAAYIALVVCGFFLKAATSPFWSMPGRIASAEVA
GGARGVINGLGNLGGFCGPYLVGVMIYLYGQNVAVCGLAVSLIIAGIIAWRLPKECDLTG
SEPTHDKLLGNAKRA