Protein Info for IAI46_12765 in Serratia liquefaciens MT49

Annotation: cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 26 (8 residues), see Phobius details PF00034: Cytochrom_C" amino acids 48 to 146 (99 residues), 25.6 bits, see alignment E=3.8e-09 amino acids 325 to 407 (83 residues), 35.5 bits, see alignment E=3.1e-12 PF13442: Cytochrome_CBB3" amino acids 323 to 405 (83 residues), 38 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: None (inferred from 84% identity to spe:Spro_2490)

Predicted SEED Role

"Isoquinoline 1-oxidoreductase beta subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.3.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>IAI46_12765 cytochrome c (Serratia liquefaciens MT49)
MSSIKKIAGWGSLTVVAAVVIGAIASWQSEIAPLEEKDHHVFSQQQIAQGKVLADLGDCA
VCHTRPGGERNTGGLAMEIPFGTIYSTNITPDNDTGIGKWSYAAFERAMRHGVDREGHYL
YPAFPYTAFTRTSDEDLQALYAYLMSQPAVKYQPPATELGFPFNIRQGIVTWNWLFLKPG
AMKADPTQSAEWNRGAYLTEGLGHCSACHSPRNLMFGEKGGAEHLSGGVAEDWTAPSLTG
SSLAPLEWTQDDLLSFMRTGYSANHGVAAGPMAPVIEEGLSRLPEQDLQAIATYLHTYHT
SESKVTEAKRLNEWAESRTEPLTTEGARIFSGACMACHAQEKGAQLIGVRPSLALNTNLY
ADKPDNAIRVVLDGIQRPANSNLGYMPAFRHNLNDRQIAELLNYLRQNYAGKAPWPELQA
QVSRLRDQTAEK