Protein Info for IAI46_12720 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 412 to 433 (22 residues), see Phobius details amino acids 475 to 496 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 25 to 434 (410 residues), 268.6 bits, see alignment E=5.2e-84 PF07690: MFS_1" amino acids 29 to 421 (393 residues), 205.7 bits, see alignment E=1.5e-64 PF06609: TRI12" amino acids 36 to 451 (416 residues), 32.1 bits, see alignment E=6.9e-12 PF00083: Sugar_tr" amino acids 60 to 194 (135 residues), 44 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: None (inferred from 95% identity to spe:Spro_2480)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>IAI46_12720 MFS transporter (Serratia liquefaciens MT49)
MGIGHLAGSEDSGRASGQAPSIRLLFSALLLVMLLAALDQTIVSTALPTIVGEFGGLENL
SWVVTAYLLASTIVVPLYGKFGDLFGRKIVLQIAIVVFLLGSVLCGLAQNMTQLILMRAL
QGLGGGGLLVVTMAVVGDVIPPAERGRYQGLFGGVFGLATVVGPLIGGVLVQHFSWRWIF
YINLPLGIFALLVIGAVFQSRVNRVKHEIDFLGASYLAAALTCIILFTSQGGTVMAWSDG
QLWCILAFGLVSLGGFIYEERLASEPIIPLDLFRNRTFLLCALVGFIVGMSLFGSVTFLP
LYLQVVKNSTPTQAGMQLLPLMGGIMISSIVSGRLISKRGKYRIFPIIGTCCALVGMILL
GTLKNSTPVHLLYLYISLLGLGLGMVMQVMILAAQNSVEPKHMGVATSSATLFRSIGGSI
GVAVFGAIFTNVLHSRLASLLPEGTALPRSLGAAAVHHLPLTLQNDYLQAFGGAIHSVYQ
IAAGVMALAFALTWLLKDVPLRHK