Protein Info for IAI46_12715 in Serratia liquefaciens MT49

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 35 to 367 (333 residues), 272.2 bits, see alignment E=2.6e-85 PF00529: CusB_dom_1" amino acids 35 to 353 (319 residues), 42.2 bits, see alignment E=1.3e-14 PF16576: HlyD_D23" amino acids 55 to 285 (231 residues), 53.7 bits, see alignment E=3.5e-18 PF13533: Biotin_lipoyl_2" amino acids 63 to 107 (45 residues), 37.8 bits, see alignment 2.6e-13 PF13437: HlyD_3" amino acids 171 to 282 (112 residues), 30.7 bits, see alignment E=8.6e-11

Best Hits

Swiss-Prot: 57% identical to MEXA_PSEAE: Multidrug resistance protein MexA (mexA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03585, membrane fusion protein (inferred from 90% identity to spe:Spro_2479)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>IAI46_12715 efflux RND transporter periplasmic adaptor subunit (Serratia liquefaciens MT49)
MQRKKVLLVSLSLLLAACDGQSGGAPAGAGSVQEVGVATLQAQPVTLSSDLTGRVNATMT
SDVRPQVDGIIKKRLFTEGAEVKAGQVLYQIDPATYQASYDQAAAQLKSAEATVKSSRLK
AQRYAALVKENGVSKQDADDAMATYLEAVAAVAQYQASLESAKINLAYTQVRAPISGRIG
ISSVTPGALVTASQTDALATIRALDPIYVDLTQSSSQLLKLRKQQASLQRDDVTPVAIKL
EDGTPYTHPGKLELTEVAVDESTGSVTLRAVFPNPEHELLPGMYVHATVDNGVNPKGILA
PQQGITRNAKGEATALVVNAQNKVEQRTIITEQVIGSNWLVSKGLNAGDRLIVEGTNKVA
AGIEVKAVDVKQPTANGGEQ