Protein Info for IAI46_12690 in Serratia liquefaciens MT49
Annotation: long-chain fatty acid--CoA ligase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 88% identity to spe:Spro_2474)Predicted SEED Role
"Acetyl-coenzyme A synthetase (EC 6.2.1.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 6.2.1.1)
MetaCyc Pathways
- oleate β-oxidation (29/35 steps found)
- superpathway of fatty acids biosynthesis (E. coli) (40/53 steps found)
- chitin deacetylation (4/4 steps found)
- ethanol degradation II (3/3 steps found)
- ethanol degradation IV (3/3 steps found)
- superpathway of acetate utilization and formation (3/3 steps found)
- γ-linolenate biosynthesis II (animals) (2/2 steps found)
- acetate and ATP formation from acetyl-CoA III (1/1 steps found)
- acetate conversion to acetyl-CoA (1/1 steps found)
- long-chain fatty acid activation (1/1 steps found)
- palmitate biosynthesis III (21/29 steps found)
- phytol degradation (3/4 steps found)
- L-isoleucine biosynthesis V (2/3 steps found)
- ethanol degradation III (2/3 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
- fatty acid salvage (4/6 steps found)
- stearate biosynthesis II (bacteria and plants) (4/6 steps found)
- stearate biosynthesis IV (4/6 steps found)
- linoleate biosynthesis II (animals) (1/2 steps found)
- reductive glycine pathway of autotrophic CO2 fixation (6/9 steps found)
- superpathway of fatty acid biosynthesis II (plant) (30/43 steps found)
- long chain fatty acid ester synthesis (engineered) (2/4 steps found)
- phosphatidylcholine acyl editing (2/4 steps found)
- alkane biosynthesis II (1/3 steps found)
- oleate biosynthesis I (plants) (1/3 steps found)
- 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
- octane oxidation (2/5 steps found)
- wax esters biosynthesis II (1/4 steps found)
- 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
- arachidonate biosynthesis III (6-desaturase, mammals) (2/7 steps found)
- ceramide degradation by α-oxidation (2/7 steps found)
- icosapentaenoate biosynthesis II (6-desaturase, mammals) (2/7 steps found)
- sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
- adlupulone and adhumulone biosynthesis (1/6 steps found)
- colupulone and cohumulone biosynthesis (1/6 steps found)
- lupulone and humulone biosynthesis (1/6 steps found)
- stearate biosynthesis I (animals) (1/6 steps found)
- capsaicin biosynthesis (1/7 steps found)
- icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
- cis-geranyl-CoA degradation (1/9 steps found)
- ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
- sporopollenin precursors biosynthesis (5/18 steps found)
- cutin biosynthesis (2/16 steps found)
- superpathway of bitter acids biosynthesis (3/18 steps found)
- suberin monomers biosynthesis (3/20 steps found)
KEGG Metabolic Maps
- Fatty acid metabolism
- Glycolysis / Gluconeogenesis
- Propanoate metabolism
- Pyruvate metabolism
- Reductive carboxylate cycle (CO2 fixation)
Isozymes
Compare fitness of predicted isozymes for: 6.2.1.1, 6.2.1.3
Use Curated BLAST to search for 6.2.1.1 or 6.2.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (512 amino acids)
>IAI46_12690 long-chain fatty acid--CoA ligase (Serratia liquefaciens MT49) MLNLSTLLEESARTFPDRLALVQDEFQLSYGELDQLANQVAHLLRIRGVKPGERVALACP NRWEFPAIYFGILKAGAVVVPLNILLKAGEFEYYLQDSQAVAFFCFEGGHGLTLGEEAKI AFDATQSCRDFIIIGDSLPLSGDRFSQAIRQQPTDFDSASTLESDTAVILYTSGTTGRAK GAELTHSNLVLNALVSAQLFNSSVERPDRHLVTLPLFHTFGSTVQMNAGFALGATLVLMP RFDAKLAISLMQKHAITFFAGVPTMYWALLNALDDSVDLAMLRKNLRMAVSGGASLPVQI IEDFARRFGVNILEGYGLSETSPVATFNHPGRVNKVGSIGQPIWGVEVRLVDVTGKTITE IDQVGELAVRGHNVMKGYLNRPEATAEVLENGWFRTGDLARRDADGVYFIVDRSKDVIIR GGFNVYPREVEELMIRHPAVSLVAVIGVPHPSLGEEIKAVVVLKDLDEAVTEEALITWTK ERLAAFKYPRIVEFVERLPMTSTGKVLKRLLR