Protein Info for IAI46_12680 in Serratia liquefaciens MT49

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 376 to 402 (27 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 445 to 464 (20 residues), see Phobius details PF00324: AA_permease" amino acids 31 to 472 (442 residues), 360.1 bits, see alignment E=1.8e-111 PF13520: AA_permease_2" amino acids 35 to 458 (424 residues), 148.4 bits, see alignment E=3.2e-47

Best Hits

Swiss-Prot: 54% identical to CYCA_ECOL6: D-serine/D-alanine/glycine transporter (cycA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 95% identity to spe:Spro_2472)

MetaCyc: 54% identical to D-serine/alanine/glycine:H+symporter (Escherichia coli K-12 substr. MG1655)
RXN0-5130; RXN0-5201; RXN0-5202; RXN0-5203; TRANS-RXN-62A; TRANS-RXN-62B

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>IAI46_12680 amino acid permease (Serratia liquefaciens MT49)
MTKSKQHRLKASSTEGHDCAQTLQRGLSERHIQLISIGGAIGTGLFMGSGKTIALSGTSI
VLTYVIVGFFMFMVMRAMGELLLTKLDYRSFADFVSEYLGPKASFFLGWSYWLSWVVTCI
ADVVVCGGYIQYWYPEVSPWLPALLTLGLLCLFNMLSVKMFGEAEFWFAIIKVIAIIALI
VTGAWMVFIGWTSPDGVKASVNNITDPAIFMPHGILGFFAGFQIAIFSCTGIELLGTMSA
ETKDPHKVLPKAINVIPVRIIIFYVFSMLAIIAVTSWSHISPDSSPFVMLFDQAGLPAAA
AVINFVALTSAMSSANSGVYSSTRMLYGLSMEKHAHGQFKILSRTTAIPIRSLMFSCFCM
VVGTMLLILMPNVMTLFTIVSTVAAILVVYSWGMILAAYLVYRKQRPDLHARSLFKMPGG
VIMTWLTLAFFAFTLVLMIFDRDTLIALCSMPLWFITLAIVWRFRIKDSVAQEGYVFYQS
HREAE