Protein Info for IAI46_12660 in Serratia liquefaciens MT49

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02525: Flavodoxin_2
  • amino acids 1 to 215 (215 residues), 183.3 bits, E=4.4e-58
• PF03358: FMN_red
  • amino acids 1 to 158 (158 residues), 32 bits, E=8.6e-12

Best Hits

KEGG orthology group: K00355, NAD(P)H dehydrogenase (quinone) [EC: 1.6.5.2] (inferred from 88% identity to spe:Spro_2460)

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2, 1.6.99.-

Use Curated BLAST to search for 1.6.5.2 or 1.6.99.-

Protein Sequence (257 amino acids)

>IAI46_12660 NAD(P)H-dependent oxidoreductase (Serratia liquefaciens MT49)
MNVLIVYAHPEPQSLNGSLRDFSVQRLEAAGHAVQVSDLYVMQWKATLDANDSTAQSGDR
FNPSLDSQQAFAQGLQSKDIELEQEKLLWADTVILQFPLWWFSMPAILKGWVERVYAYGF
AYGVGEHSDVRWGDRYGEGTLAGKRAMLIVTTGGWESHYAQRGINGPIDDILFPIQHGIL
HYPGFEVLPPFVLYRTGRVDEARFAEACNALGQRLDELEQTSPIPFRRQNAGEYEIPALT
LKPDIAPGRKGFSAHIE