Protein Info for IAI46_12610 in Serratia liquefaciens MT49

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF12146: Hydrolase_4" amino acids 23 to 124 (102 residues), 53.6 bits, see alignment E=6.3e-18 amino acids 207 to 258 (52 residues), 27 bits, see alignment 8.1e-10 PF00561: Abhydrolase_1" amino acids 24 to 258 (235 residues), 99.1 bits, see alignment E=9.9e-32 PF12697: Abhydrolase_6" amino acids 25 to 267 (243 residues), 68.9 bits, see alignment E=3.1e-22 PF00326: Peptidase_S9" amino acids 186 to 274 (89 residues), 28 bits, see alignment E=4.5e-10 PF03959: FSH1" amino acids 211 to 263 (53 residues), 21.8 bits, see alignment E=4.1e-08

Best Hits

Swiss-Prot: 65% identical to PRXC_STRLI: Non-heme chloroperoxidase (cpo) from Streptomyces lividans

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 91% identity to cko:CKO_04375)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>IAI46_12610 alpha/beta hydrolase (Serratia liquefaciens MT49)
MGYVTTSDGVDIFYKDWGPKDGKVIFFHHGWPLSSDDWDAQMLFFVNQGFRVVAHDRRGH
GRSSQVSEGHDMDHYADDVAAVVKHLSVQGAMHVGHSTGGGEVVRYITRHGEDKVSKAVL
ISAVPPLMVKTDSNPQGTPKSVFDDFQAQLAANRAQFYYDVPAGPFYGYNRPGAKPLDAV
IWNWWRQGMMGGAKAHYDGVVAFSQTDFTDDLKRISIPVLVIHGDDDQVVPYQDSGVLSA
KLVKNGKLITYKGAPHGIPTTHADRVNSDLLAFVNS