Protein Info for IAI46_12570 in Serratia liquefaciens MT49

Annotation: formate hydrogenlyase transcriptional activator FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 PF13185: GAF_2" amino acids 198 to 342 (145 residues), 51.2 bits, see alignment E=6.3e-17 PF01590: GAF" amino acids 199 to 341 (143 residues), 49.5 bits, see alignment E=2.6e-16 PF13492: GAF_3" amino acids 199 to 343 (145 residues), 32.1 bits, see alignment E=5.5e-11 PF00158: Sigma54_activat" amino acids 378 to 544 (167 residues), 244.3 bits, see alignment E=2.3e-76 PF14532: Sigma54_activ_2" amino acids 379 to 549 (171 residues), 73.8 bits, see alignment E=7.1e-24 PF01078: Mg_chelatase" amino acids 389 to 519 (131 residues), 21.1 bits, see alignment E=7.4e-08 PF07728: AAA_5" amino acids 402 to 532 (131 residues), 37.4 bits, see alignment E=1e-12 PF02954: HTH_8" amino acids 644 to 683 (40 residues), 23.1 bits, see alignment 2e-08

Best Hits

Swiss-Prot: 65% identical to FHLA_ECOLI: Formate hydrogenlyase transcriptional activator FhlA (fhlA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to spe:Spro_2440)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (688 amino acids)

>IAI46_12570 formate hydrogenlyase transcriptional activator FlhA (Serratia liquefaciens MT49)
MSNAQLEKQELLEITRTLLSQRSFTDLLLQLRQILQRLQLADQVTLVLFDPDSERVSFYG
LDAHRQPVSYQDETLLANGPVSRLRQSPLPQRWQSDDLHARYPQIGALALYLPFNQYCLM
PLHAGGTLIGGCEVLRCHSAPFADASLVQLQTLMELVALAAEQLLLREEAELRQRQLRHE
RDDYRILVDVTNAVLSKLDLDDLIGEISKEIHRFFKIDAISIVLCVDKTEQVTIYSTHYL
QDDVVERQQYSVALAGTLSEQVMQSGEMLLLNLKHSDRLAAYERQLFDLWHEQIQTLCVL
PLVFGNKTLGVLKLAQCQPDNFNAANLRVLQQIAERIAIAVDNALAYQEINRLKESLVHE
NLYLTEQINGNNPDFGEIVGRSVVMSAVLKQVEMVAKSDCSVLILGETGTGKELIARAIH
NLSERRDQRMVKMNCAVMPAGLLESDLFGHEKGAFTGATNQRMGRFELADKGTLFLDEVG
EIPVELQPKLLRVLQEREFERVGGNKVISVDVRLIAATNRDLQQMVADREFRSDLFYRLN
VFPIVIPPLRERPEDIPQLVKFLTYKIARRMKRTIDSIPAETLRLLSQMPWPGNVRELEN
VIERAVLLTRGTVLNLQLPELQYPVPSMALPVPKAEPSQPGEDERQQIIRVLKETNGVVA
GPRGAAQRLGLKRTTLLSRMKKWGILVK