Protein Info for IAI46_12560 in Serratia liquefaciens MT49

Annotation: hydrogenase formation protein HypD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00075: hydrogenase expression/formation protein HypD
  • amino acids 3 to 369 (367 residues), 530.8 bits, E=7.9e-164
• PF01924: HypD
  • amino acids 13 to 367 (355 residues), 497.5 bits, E=1.1e-153

Best Hits

Swiss-Prot: 71% identical to HYPD_ECOLI: Hydrogenase maturation factor HypD (hypD) from Escherichia coli (strain K12)

KEGG orthology group: K04654, hydrogenase expression/formation protein HypD (inferred from 92% identity to spe:Spro_2438)

MetaCyc: 71% identical to Fe-(CN)2CO cofactor assembly scaffold protein HypD (Escherichia coli K-12 substr. MG1655)
RXN-22646; RXN-22647

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypD" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (8/10 steps found)

Protein Sequence (375 amino acids)

>IAI46_12560 hydrogenase formation protein HypD (Serratia liquefaciens MT49)
MDYVDEFRDPQRVKKLLQHIWHRAAQLPFTAERPLQIMEVCGGHTHAIFRFGLDKLLPAH
IEFIHGPGCPVCVLPMGRIDACCEIAEHPEVIFCTFGDALRVPGQQGSLLQARERGADVR
VVYSPLDALMLARQNPQRQVVFFALGFETTMPVTAITLQQARQEGLGNFSVFCQHISLIP
TLRSLLQQPDVRIDGFLAPGHVSMVIGTEPYHFISRQYRKPLVVTGFEPLDILQGVLMLV
EQFLGRQSQTENQYRRVVPEQGNRLAQQAMSEVFVLGGGSEWRGLGTIADSGIALTPGYQ
AFDAERRFRPQRRQVADDPRSRCGDVLTGRCKPRDCPLFGRGCTPQNAFGALMVSSEGAC
AAWYQYRRETEETPA