Protein Info for IAI46_12525 in Serratia liquefaciens MT49

Annotation: respiratory chain complex I subunit 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00146: NADHdh
  • amino acids 16 to 306 (291 residues), 179.7 bits, E=4.3e-57

Best Hits

Swiss-Prot: 66% identical to HYCD_ECOLI: Formate hydrogenlyase subunit 4 (hycD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to spe:Spro_2431)

MetaCyc: 66% identical to hydrogenase 3 membrane subunit HycD (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]; FHLMULTI-RXN [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 4" in subsystem Formate hydrogenase

MetaCyc Pathways

• mixed acid fermentation (16/16 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production V (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (3/6 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Protein Sequence (313 amino acids)

>IAI46_12525 respiratory chain complex I subunit 1 family protein (Serratia liquefaciens MT49)
MTMTYPNVLLGLAQALLLLAVAPLFAGVSRVLRARMHNRRGPGVLQEYRDIAKLLKRQNV
APAASGLAFHAMPYLLTGTLLAIACALPMLTVASPLPAIGDVITLIYLFAVVRFVFAIAG
LDTGSPFTAIGASREAVLGILVEPILLLGLWVTALVAGSTQLSAMVQSLLALPHPAWLPL
LLAALACAFATYIEMGKLPFDLAEAEQELQEGPLTEYSGAELGILKWGISLKQLVVLQLF
LGVFLPWGQAAQFTVLHLSAALVLALLKLLCALTLIAIIENSVARLRFLKTARTTWAGFG
LAFLALVSWLVVG