Protein Info for IAI46_12495 in Serratia liquefaciens MT49
Annotation: electron transport protein HydN
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to HYDN_ECO57: Electron transport protein HydN (hydN) from Escherichia coli O157:H7
KEGG orthology group: K05796, electron transport protein HydN (inferred from 96% identity to spe:Spro_2425)MetaCyc: 46% identical to hydrogenase (NADP+,ferredoxin) epsilon2 subunit (Clostridium autoethanogenum)
1.17.1.M4 [EC: 1.17.1.M4]
Predicted SEED Role
"Electron transport protein HydN"
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.17.1.M4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (180 amino acids)
>IAI46_12495 electron transport protein HydN (Serratia liquefaciens MT49) MNRFIIADPKKCIGCRTCEIACVMAHSESQDISALNATSFAPRLHVIKGVNVSTAVLCRQ CEDAPCANVCPNGAISRTNGMVLVMQERCIGCKTCVVACPYGAMEVITRPVVRQNGAMMS ATSEKAEAHKCDLCIGRDSGPACMETCPTNALHCVDRNMLQEMNAEKRRRAALDTMSSLF