Protein Info for IAI46_12495 in Serratia liquefaciens MT49

Annotation: electron transport protein HydN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF12800: Fer4_4" amino acids 9 to 22 (14 residues), 12.9 bits, see alignment (E = 7.3e-05) amino acids 87 to 102 (16 residues), 24.6 bits, see alignment (E = 1.2e-08) PF13247: Fer4_11" amino acids 56 to 156 (101 residues), 42 bits, see alignment E=5e-14 PF13187: Fer4_9" amino acids 58 to 104 (47 residues), 29.8 bits, see alignment E=2.6e-10 PF12797: Fer4_2" amino acids 81 to 101 (21 residues), 28.6 bits, see alignment (E = 5e-10) PF12837: Fer4_6" amino acids 82 to 103 (22 residues), 30.7 bits, see alignment (E = 1.2e-10) PF13237: Fer4_10" amino acids 83 to 148 (66 residues), 27.2 bits, see alignment E=1.8e-09 PF00037: Fer4" amino acids 84 to 104 (21 residues), 31.7 bits, see alignment (E = 5.2e-11) PF12838: Fer4_7" amino acids 88 to 151 (64 residues), 27.6 bits, see alignment E=1.9e-09 PF12798: Fer4_3" amino acids 89 to 103 (15 residues), 17.6 bits, see alignment (E = 3e-06)

Best Hits

Swiss-Prot: 71% identical to HYDN_ECO57: Electron transport protein HydN (hydN) from Escherichia coli O157:H7

KEGG orthology group: K05796, electron transport protein HydN (inferred from 96% identity to spe:Spro_2425)

MetaCyc: 46% identical to hydrogenase (NADP+,ferredoxin) epsilon2 subunit (Clostridium autoethanogenum)
1.17.1.M4 [EC: 1.17.1.M4]

Predicted SEED Role

"Electron transport protein HydN"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.M4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>IAI46_12495 electron transport protein HydN (Serratia liquefaciens MT49)
MNRFIIADPKKCIGCRTCEIACVMAHSESQDISALNATSFAPRLHVIKGVNVSTAVLCRQ
CEDAPCANVCPNGAISRTNGMVLVMQERCIGCKTCVVACPYGAMEVITRPVVRQNGAMMS
ATSEKAEAHKCDLCIGRDSGPACMETCPTNALHCVDRNMLQEMNAEKRRRAALDTMSSLF