Protein Info for IAI46_12485 in Serratia liquefaciens MT49

Annotation: carbamoyltransferase HypF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 TIGR00143: carbamoyltransferase HypF" amino acids 8 to 750 (743 residues), 850.8 bits, see alignment E=4.2e-260 PF00708: Acylphosphatase" amino acids 9 to 89 (81 residues), 58.4 bits, see alignment E=1.4e-19 PF07503: zf-HYPF" amino acids 107 to 140 (34 residues), 63.9 bits, see alignment (E = 1.9e-21) amino acids 157 to 187 (31 residues), 48.2 bits, see alignment (E = 1.5e-16) PF01300: Sua5_yciO_yrdC" amino acids 210 to 385 (176 residues), 142.1 bits, see alignment E=2.7e-45 PF17788: HypF_C" amino acids 403 to 498 (96 residues), 113 bits, see alignment E=1.9e-36

Best Hits

KEGG orthology group: K04656, hydrogenase maturation protein HypF (inferred from 84% identity to spe:Spro_2423)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypF" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (770 amino acids)

>IAI46_12485 carbamoyltransferase HypF (Serratia liquefaciens MT49)
MSYPGLLLRISGKVQGVGFRPFVWQLANQLNLRGEVWNDSAGVEIRLVNPVDLELLLHLL
CQQAPPLAQIDNIQQRPFTWLKKPDDFRIRASQRGAMTTQIVPDAATCPKCLQEMNDPQD
RRYRYPFINCTHCGPRFTIIRAMPYDRPATSMAPFPLCSPCAQEYRSAHDRRFHAQPVAC
SDCGPQLFSFTVEGQPQHQEEEALQQAVAALAAGQIVAIKGLGGFHLACDATQTEAVERL
RLRKRRPGKPLAVMLPNIRWLTRCTRGIDLARAQALLASAAAPIVLVPHSYHSPLSEAIA
PQLNEVGLMLPANPLHHLLMQEIQRPLVMTSGNATGRAPALTNSQALADLAGIADLWLLH
DREILQRADDSLVRLLPEGHEMLRRARGFVPDALPLPPGFPSQPPLLAVGGDRKNTFCLL
QGNKAVLSSHFGDLQQEDIQQQWQQAMAHFMALYHCQPQRLASDAHPGYVSHQWAARQRL
PVTPVLHHHAHLAACLAEHHWPLEGGAVIGLALDGLGYGQDGALWGGECLWVDYRRCRHL
GGLPAVALPGGDLAAQQPWRNQLAHFARFVPDWQNSPQAERLLTRAWRPLLQAINASINA
PLASSCGRLFDAAAAALGCAPERQSWEGEAASIFEALAHQSGPCSHPVTLPRCAEQLDLG
VLWRQWLAWQAPAAQRAWAFHDALAQGFAGLAKHFAAEHNLRHVALSGGVLHNRLLRQRL
QHHLAPLHVLLPQRLPAGDGGLAFGQALVACAQRIPLTRLPFKTQQDVTC