Protein Info for IAI46_12480 in Serratia liquefaciens MT49

Annotation: HoxN/HupN/NixA family nickel/cobalt transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 54 (15 residues), see Phobius details amino acids 80 to 108 (29 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 264 to 290 (27 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details PF03824: NicO" amino acids 42 to 331 (290 residues), 330 bits, see alignment E=6.4e-103 TIGR00802: transition metal uptake transporter, Ni2+-Co2+ transporter (NiCoT) family" amino acids 45 to 326 (282 residues), 392.3 bits, see alignment E=6.9e-122

Best Hits

Swiss-Prot: 54% identical to HOXN_CUPNH: High-affinity nickel transport protein (hoxN) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K07241, high-affinity nickel-transport protein (inferred from 94% identity to spe:Spro_2422)

Predicted SEED Role

"HoxN/HupN/NixA family nickel/cobalt transporter" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>IAI46_12480 HoxN/HupN/NixA family nickel/cobalt transporter (Serratia liquefaciens MT49)
MLNREFFHTHTRAFWLLLTLVALNLLAWGAAFAAFHHHPALIAAALLAYGYGLRHAVDAD
HIAAIDNVTRKLMQQGQRPVSVGAFFSLGHSSIVVLACIAIAATSLAFGDRIGWLHQYGA
TLGTLISSLFLLVMALLNWLIFRDVYRIFRRVKRGETLVEQDVALLVSGSGGVMTRLYRF
AFNLVNKSWHMYLVGFLFGLGFDTATEVGLLGISATGATSGMSVWSIMVFPLLFASGMAL
IDSLDNFVMVGAYGWAFNKPIRKLYYNMTITATSVVIAVVIGGLEGLGLLADKLGLQGGL
WRGVEVLNDNLGSVGYAAIVLFVVLWILSALNYRRKNYDSLSV