Protein Info for IAI46_12475 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 13 to 39 (27 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 211 to 238 (28 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 279 to 295 (17 residues), see Phobius details amino acids 301 to 327 (27 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 270 (253 residues), 47.2 bits, see alignment E=7.7e-17 amino acids 245 to 386 (142 residues), 44.2 bits, see alignment E=6.4e-16

Best Hits

KEGG orthology group: None (inferred from 76% identity to pfo:Pfl01_3637)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>IAI46_12475 MFS transporter (Serratia liquefaciens MT49)
MANPYRELLTTPGVGGLVIASSVARLPQAMIGIGIITMLVQQSGHYWLAGAVAGIFTLAN
ALMGPQVSKLVDRLGQNRVLPWVTAFSITMLLALITAAHMRAPVPLLCILAMLAGTMPSM
PAMIRARWTQLFRGKPQLHTAFSLDTVLTELTFVIGPPLSIGLSTGIAAEAGPLAAIVLL
VIGVTAFLLQRQTAPKVIKNTTEHRGSTLRIPGLGTIVLALLAMGVIGGSIDVAVVAFAN
VQGWPTAASLILAAYAFGSMVAGLAFGAIRVSLPIERQFFIGVLLTAATSVLPLLSADVY
ILMATIFVAGMSFAPTMVVVMNLGTILVPPSRLTEGLTWMTTGISIGVALGAALAGLVID
AYGARAGFGIAIAAGVVMTIIVLLGRRTLHAASMPQGGATCS