Protein Info for IAI46_12395 in Serratia liquefaciens MT49

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02129: Peptidase_S15" amino acids 58 to 200 (143 residues), 30.5 bits, see alignment E=4.8e-11 PF01738: DLH" amino acids 65 to 180 (116 residues), 30.2 bits, see alignment E=5e-11 PF12146: Hydrolase_4" amino acids 80 to 325 (246 residues), 28.7 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 82% identity to yep:YE105_C1211)

Predicted SEED Role

"FIG01220323: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>IAI46_12395 alpha/beta hydrolase (Serratia liquefaciens MT49)
MKFTRLNSLILVAVAGFSVTVNAADYKQNPYTLAYEGAITENVQGKINIRPVKYDLHGIQ
IAANIYIPANYDPAKKYQAIVVAHPNGGVKEQVAGLYAQRLAEHGFITIAADAAYQGASG
GLPRSVDKPANRIEDIHGMADFLSQYPGVDAERIGLLGICGGGGYSLKAAQTDKRFKALA
TISMFDSGLVRRNGYQNSQISSIQQRLTQASLARAKEATTGEITYTGDAKLTDEQIARLP
FDLYRQGFEYYGKTHAHPNSTFRYTLSSLLDLMSFDAQSNMDLINQPLLMIAGTRADSLY
MTESAFPKAINAKSKELFLIEGATHIETYWVPNYVVQAINKLDAFFDKNI