Protein Info for IAI46_12390 in Serratia liquefaciens MT49

Annotation: heavy metal response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR01387: heavy metal response regulator" amino acids 3 to 221 (219 residues), 292.1 bits, see alignment E=1.3e-91 PF00072: Response_reg" amino acids 4 to 112 (109 residues), 94.6 bits, see alignment E=4.4e-31 PF00486: Trans_reg_C" amino acids 149 to 221 (73 residues), 84.1 bits, see alignment E=5.7e-28

Best Hits

Swiss-Prot: 49% identical to HPRR_ECOLI: Transcriptional regulatory protein HprR (hprR) from Escherichia coli (strain K12)

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 88% identity to yen:YE3024)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>IAI46_12390 heavy metal response regulator transcription factor (Serratia liquefaciens MT49)
MRLLLVEDEEKTASYIRHALAESGFIVDVSAEGPEGVHYALEYDYDAIILDVMLPGMDGY
RVLESIRARKQTPILMLSARGSVDERVKGLRLGADDYLPKPFSLIELVARIQALVRRWGN
DGLDITQLQLHDLHIDILARRVFRGDIRLELSTKEFSLLSLLARHQGEIMSKMMIAEQVW
DMNFDSDANVVEVAIKRLRAKIDAPFEVKLLHTVRGMGYILEVRG