Protein Info for IAI46_12300 in Serratia liquefaciens MT49

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 151 to 179 (29 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 24 to 297 (274 residues), 50.1 bits, see alignment E=3.2e-17 PF00005: ABC_tran" amino acids 358 to 506 (149 residues), 90.7 bits, see alignment E=1.4e-29

Best Hits

KEGG orthology group: None (inferred from 74% identity to spe:Spro_2402)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>IAI46_12300 ABC transporter ATP-binding protein (Serratia liquefaciens MT49)
MNKFLFIIRYFKGTSNLSAKGNFFVIITISLLSTVLISVQPVIMAKLISGIESESVDFKF
IIYALALSYIVVMSLRKLASALNFILITSLRSNLVISMTNDYFKSLFYNADAIKIHENTG
DITQRLNQAIDELTVLLRNISHNFIPPLLQLVLSVAFIVISGDYIVAMLFTLYFLLYFII
KGVFNPKIVGLYNDFYNTSVKKYSLITDSVKNMGAAKVCNSYDYLFGRYEALLHKIETKH
EKLLKADMHFLLVESACNIIFFGLSFLYSLYQVMSGNISIGHFVMISSYILLLSSPLESM
GSMYTALQKSTVSLYGFISAMTMIVARQVDSEQIKPVDSMKMRDLSFSYQGEGGAIIKGL
NLEIDKGHFITLTGRSGSGKSTVAKLLAGELKPEQGEILINNMNINELSSVQRAELVFHV
SQNDYIFMDTLRFNLKIACPEATDEQLAVALRLSRLDDLVNDGNADLLDMRIGDNGVTLS
GGQRQRLSLARLFLRTPSIIILDEVTSALDVINERGIMHNIKICFPNALILNISHRSSTF
DFSDEILVMDSGRIVASGDFVTLKNNNAYIQSILRQEALKQAS