Protein Info for IAI46_12280 in Serratia liquefaciens MT49

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 172 to 197 (26 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 88 (67 residues), 49.2 bits, see alignment E=3e-17 PF00528: BPD_transp_1" amino acids 38 to 233 (196 residues), 68.8 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: None (inferred from 97% identity to spe:Spro_2399)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>IAI46_12280 ABC transporter permease subunit (Serratia liquefaciens MT49)
MNLQNMLEAAPSFLWSDGSDVTGLAMTAKLFLLSVVPGLVLAMLMAIGQVYGPRPLSYLI
RSVTYFFRSTPLYLQLMLIYYGLSQFDVVQLGWQNDQPFWLLFRDATFCATLALVLNTSA
YVAQLLAGMMETFPRQEWIAGEAYGMSQRQIIRRLVLPATLRRGIPALNNEMVFLLHATS
LASTVTLLDITGVARALYAATYSPFIPFLMAAALYLLCTFLLIFLFSRAERRWLGFIRRD