Protein Info for IAI46_12275 in Serratia liquefaciens MT49

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 146 to 155 (10 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 6 to 114 (109 residues), 60.5 bits, see alignment E=9.1e-21 PF00528: BPD_transp_1" amino acids 28 to 219 (192 residues), 84.3 bits, see alignment E=4.5e-28

Best Hits

Swiss-Prot: 37% identical to OCCQ_AGRT4: Octopine transport system permease protein OccQ (occQ) from Agrobacterium tumefaciens (strain Ach5)

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_2373)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>IAI46_12275 ABC transporter permease subunit (Serratia liquefaciens MT49)
MVTEYLPLLAQGAALSLCVMLVSLAVALALGLVNALIKLFGPRWLRWVSTGYTTLVRGIP
ELVIMLLLFFGGEMLVNGALGLLGLGPLRFNTFISGVLAIGFVFGAYYTETFRGAFLTVE
RGQLEAAMAYGMSPGQVFRRVLLPQMLSFAIPGINNNWLGLMKASALVSILGLEDMVWLA
EQAGRATQKPFLFYFLVALIYMAITAISSWGFSRLSRRYALASSNAGAR