Protein Info for IAI46_12255 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 326 (300 residues), 113.2 bits, see alignment E=6.5e-37 amino acids 227 to 404 (178 residues), 37.4 bits, see alignment E=7.3e-14

Best Hits

KEGG orthology group: None (inferred from 88% identity to srr:SerAS9_2369)

Predicted SEED Role

"MFS permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>IAI46_12255 MFS transporter (Serratia liquefaciens MT49)
MTLISPANHTGTTPAHALSAKVVFLLATGAGLSVASIYYSQPMLGIMGDAFHAGVSDAGW
VPTLTQAGYALGILLLAPLGDRHDRRQIIRIKGMLLAVTLLFCGFSSSFPLLLVSSLAIG
LAATVAQDIIPAAATLATDANRGKTVGTVMTGLLAGILLSRVFSGVVAEYFGWRSVYLLA
AVAVLAISFAIGAVLPRLKPNTALSYPALLRSLGQLWADYPELRRAALAQGLLSIAFSAF
WSTLAVMLAERYQLGSAVAGAFGLAGAAGALAAPLAGMLADRHGPDYVTKIGAAMVVVSF
ALMFLLPLLSLPAQLALIALSAVGFDLGIQATLVAHQTIIYAINPAARSRLNAIMFTLVF
IGMAGGAALGSKILEAAGWPGVVTLATLTAAGGLAMRLFAKTAPRVAA