Protein Info for IAI46_12250 in Serratia liquefaciens MT49

Annotation: substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00532: Peripla_BP_1
  • amino acids 25 to 229 (205 residues), 46.7 bits, E=3.1e-16
• PF13407: Peripla_BP_4
  • amino acids 26 to 281 (256 residues), 193.3 bits, E=5.9e-61

Best Hits

Swiss-Prot: 39% identical to MOCB_RHIML: Putative rhizopine-binding protein (mocB) from Rhizobium meliloti

KEGG orthology group: None (inferred from 94% identity to spe:Spro_2395)

Predicted SEED Role

"Galactose/methyl galactoside ABC transport system, D-galactose-binding periplasmic protein MglB (TC 3.A.1.2.3)" in subsystem Bacterial Chemotaxis or Lactose and Galactose Uptake and Utilization (TC 3.A.1.2.3)

Protein Sequence (307 amino acids)

>IAI46_12250 substrate-binding domain-containing protein (Serratia liquefaciens MT49)
MKTKSLLLILLSIVMSFSAQAKTYKVGVALANFDLNFVSILRSQMVSELKQLGMDGQFVD
AKGDVALQVQQVDDFINLGVDAIILNPVDTQGVKPMMDAAERANIPLIFVNRKPEVKLGK
DMAYVGSDSAVGGEMQMEALAKKMNYRGNVAILMGALSNEEARERTRAVEAVIAKYKDMK
VLEKQTAKWQRNEAVDVVSGWLLNGRPIDAIAANNDEMAIGAIMALNQAKNKTILVAGID
GTPDGQQFIKNGGMTLTIFQDAKGQAIGAVQVTKALLEKQKVEPYNWIPYKTITQQNLAE
FQAVNQK