Protein Info for IAI46_12235 in Serratia liquefaciens MT49

Annotation: sigma 54-interacting transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 PF01590: GAF" amino acids 113 to 217 (105 residues), 26.9 bits, see alignment E=1.9e-09 PF00158: Sigma54_activat" amino acids 342 to 509 (168 residues), 223.8 bits, see alignment E=3.4e-70 PF14532: Sigma54_activ_2" amino acids 346 to 514 (169 residues), 70 bits, see alignment E=7.8e-23 PF07728: AAA_5" amino acids 366 to 484 (119 residues), 27.6 bits, see alignment E=8.1e-10 PF02954: HTH_8" amino acids 603 to 643 (41 residues), 47.9 bits, see alignment 2.8e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to spe:Spro_2392)

Predicted SEED Role

"Transcriptional activator of acetoin dehydrogenase operon AcoR" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (652 amino acids)

>IAI46_12235 sigma 54-interacting transcriptional regulator (Serratia liquefaciens MT49)
MQTAAGLMPIKDESDPIFSLPEGAESGEWDSLFWQGWQAFNEGGQPGWIRKSILQSWRRS
REYGIDPDEFVYHAPPADQLLAILAHNAELIAVARSIMENLLAYNPDGHINLTDAHGVTL
HYCGADLTPIGSILREEVQGTNCTARCLLEQRLVYVLSGENWKMGLRQRHRQCAAAPVRN
AEGVMIGVLTLTATPDNFNAHTLGTVQAAAEAIGQQLKLHRLLAEQQSILETLNEGVMVC
DRHGQLKTVNRYARQIFGGLEPGDTPIDELLRPQSGSLLTMPFCNDREMVFMPVGKPALS
CVISLMPAPDNGRVLSLRENQRIRAITRRVMGVSASYTFEMIFGHSSRMREAIMQARTCS
RSDSTVLLTGESGTGKELFAQAIHNGGERCNEPFVAVNCGALPRDLVQSELFGYVDGAFT
GSRRGGSAGKFELADGGTLLLDEIGEMPLDAQTSLLRVLQEGEVLRIGAAHPVKVNVRII
AATHCDLLQAVENGAFRRDLYYRLNVLSLPVPPLRERREDIAGLVNGFIHKLSTRMKKIP
PQVSPQAMVCLNAWHWPGNVRELENLVERMVNLCEGLLIDVDDLPREIAQAFPEQEAVPS
SRLEDNERAHIIQIIESSNGNLRQAARLLGLSRTTLYNKINRWQIDLTLLRP