Protein Info for IAI46_12200 in Serratia liquefaciens MT49

Annotation: fused MFS/spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01564: Spermine_synth
  • amino acids 76 to 186 (111 residues), 30.9 bits, E=1e-11

Best Hits

KEGG orthology group: None (inferred from 86% identity to spe:Spro_2384)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (17/17 steps found)
• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• superpathway of polyamine biosynthesis I (8/8 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• spermidine biosynthesis I (2/2 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Protein Sequence (262 amino acids)

>IAI46_12200 fused MFS/spermidine synthase (Serratia liquefaciens MT49)
MSLVDKLLNSLDFSPRGQVIARELDHCGEIIVSDHKGYRTLRFDGICEQSKMCISAPQVP
VHNYIKTMLMAVAWQPPASALILGLGGGGLVRALHAYDANMLLEVVELRQAVVSVARRYF
TLPAVHNITMHIADAADFLRAPAQRRYDLIFSDLYSAFTMDPQQGTQAFLAQCAERLSDP
GWLVLNYHEVPDEGSLLYHSLHRVFNTVLYCVAPSGNVIIYAALANTETPLSLLRRLSAE
VGPSFSCDLRYLSRKIERLHFS