Protein Info for IAI46_12125 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 12 to 20 (9 residues), see Phobius details amino acids 32 to 35 (4 residues), see Phobius details transmembrane" amino acids 21 to 31 (11 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 443 to 461 (19 residues), see Phobius details PF05977: MFS_3" amino acids 17 to 198 (182 residues), 40.9 bits, see alignment E=1.5e-14 PF07690: MFS_1" amino acids 21 to 413 (393 residues), 210.6 bits, see alignment E=4.8e-66 amino acids 278 to 469 (192 residues), 61.1 bits, see alignment E=1.4e-20 PF00083: Sugar_tr" amino acids 51 to 187 (137 residues), 38.8 bits, see alignment E=8.6e-14

Best Hits

KEGG orthology group: None (inferred from 77% identity to spe:Spro_2367)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>IAI46_12125 MFS transporter (Serratia liquefaciens MT49)
MKSITQHVSPPVNLRGILASLCLSMLVSSLGASIANVGLPTLAQAFNSSFQAVQWVVIVY
LLAVTTSIIAMGRLGDRMGRRRLLLTGIALFTFASGLCAIAPGIWLLLAARVAQGLGAAV
MMAMTMALVGEAVGKENTGRAMGLLGSMSAIGTALGPSLGGALILGFGWRAMFLVNIPVG
VVAFLLVYCSLPQEQRQRQKERGRFDWAGTLLLGGTLACYALSMTLGRGDFGVVNLTLLL
GAALGMGLFVRLQKRTALPLIQLALFRQPGLSVGLAMSALVMTIMMTTLVVGPFYLTHGL
GLAVGQAGLVMSAGPIVAALLGVPAGRWVDRFGAQRITLVGLTTMAVGAGIMSMMSLNQG
VFGYVAPLCLMTLGYALFQVANNTALMKHAAPEQRGVISGMINLSRNLGLITGASAMGAL
FMLATHTGDIKLASSHAVANGMQITYLVAGALAAFALVMAARNGGVRPHEDDYSRSPR