Protein Info for IAI46_12115 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 97 to 99 (3 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 320 (311 residues), 135.2 bits, see alignment E=1.4e-43 amino acids 207 to 374 (168 residues), 49.9 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: None (inferred from 83% identity to srs:SerAS12_2328)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>IAI46_12115 MFS transporter (Serratia liquefaciens MT49)
MKILSPIFFIALGLFGVYCIEFGVVGILPLIMERYAISASQAGWLVGVFAITIALLGPLL
VLLASRFNRKRMLLISLAVFVVTSVLSAYAASFGSLLVLRILPALFHPIYFALAMVAAAS
LYPQQQVTRATAYAFVGTSMGMVLGIPLTHWIAGQFSYEASFLFCALVNLLAGIGLFFCL
PDSAPQRMGYGKQLAILRSGALWLNILACVLIFAAMFSVYAYATEYLSGEIGISGPRVGL
LLVIFGLGGVSGNLLAGKLLNRHRFAATLLHPVVLALAYGLLYLYGSTHLGTMIVLCLFW
GAAHTSGLIVTQMWLTAEAPQAPEFATGLYIAFINLGVALGSVVSGGFIDAVGLQGIMLS
GGVFAALATVTIAFKIRLYPRMGAAASHGVT