Protein Info for IAI46_12085 in Serratia liquefaciens MT49

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 88 (28 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 225 to 236 (12 residues), see Phobius details amino acids 248 to 273 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 59 to 172 (114 residues), 58.5 bits, see alignment E=3.9e-20 PF00528: BPD_transp_1" amino acids 79 to 275 (197 residues), 86.9 bits, see alignment E=7.3e-29

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 95% identity to spe:Spro_2362)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>IAI46_12085 amino acid ABC transporter permease (Serratia liquefaciens MT49)
MNGPQATGDAELRIVGHRHYGRWFSALLVLLIVGIIANSMLHNPRFEWAVVAENFTEASI
INGVIMTLKLTVISVIFGFAGGVLLALMRLSANPVLVAVSWFYTWFFRAVPMLVQLFLWY
NIAALYPRISLWIPFLGEVASAPTNTIISTFSAAVIALVMHQSAYAAEIVRAGIQSVGSG
QLEAAKALGYRRGQILWRVVLPQAMRTILPPAGNEVIGQLKTTAVVSVIALQDVLYSAQI
IYQRTYEVIPLLLVATLWYLVMTSILSIGQYYVERYFGRGSQAVRSNWLFRPRKAASSPS
QEAQS