Protein Info for IAI46_12040 in Serratia liquefaciens MT49

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00005: ABC_tran" amino acids 26 to 186 (161 residues), 102.6 bits, see alignment E=4.4e-33 PF13304: AAA_21" amino acids 153 to 221 (69 residues), 27.3 bits, see alignment E=5.2e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 321 (87 residues), 77.7 bits, see alignment E=2.8e-26 PF08352: oligo_HPY" amino acids 237 to 301 (65 residues), 63.3 bits, see alignment E=3.2e-21

Best Hits

Swiss-Prot: 69% identical to DDPD_ECOLI: Probable D,D-dipeptide transport ATP-binding protein DdpD (ddpD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 93% identity to spe:Spro_2350)

MetaCyc: 45% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2); Putative hemine transporter ATP-binding subunit" (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>IAI46_12040 ABC transporter ATP-binding protein (Serratia liquefaciens MT49)
MSETTVLSIDELQLEFPIYGGSVKALNRVSLQVKAGEIVGVVGESGSGKSVTAMMTLRLL
AEEGYRVTGGSLEMLGTDVLNASERQMRQLRGARVSMIFQEPMSALNPTRKIGRQMCEVI
RLHQRLSASAARDKAIQLLQEMQIADAQRVMERYPFELSGGMRQRVLIAMAFSCEPELII
ADEPTTALDVTVQRQVLRLLQQKARASGTAVLFITHDMAVVSQLCDRVYVMYAGHVIESG
ATAKVIEHPSHPYSIGLLLAAPERAEPRSLLQAIPGTVPNLSALPPGCAFSNRCRHADAQ
CRHTPRLTPLVAEPSQRVACWHPQSVDLEVQNER