Protein Info for IAI46_12000 in Serratia liquefaciens MT49

Annotation: multidrug efflux MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 194 (184 residues), 113.9 bits, see alignment E=1.2e-36 amino acids 216 to 384 (169 residues), 92 bits, see alignment E=5.4e-30 PF12832: MFS_1_like" amino acids 17 to 371 (355 residues), 45 bits, see alignment E=1.3e-15 PF00083: Sugar_tr" amino acids 40 to 137 (98 residues), 31.3 bits, see alignment E=1.6e-11 amino acids 249 to 384 (136 residues), 29.9 bits, see alignment E=4.2e-11

Best Hits

Swiss-Prot: 65% identical to MDTG_YERE8: Multidrug resistance protein MdtG (mdtG) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K08161, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 94% identity to srs:SerAS12_2299)

MetaCyc: 61% identical to efflux pump MdtG (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-342; TRANS-RXN0-589

Predicted SEED Role

"Multidrug-efflux transporter, major facilitator superfamily (MFS) (TC 2.A.1)" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>IAI46_12000 multidrug efflux MFS transporter (Serratia liquefaciens MT49)
MEAWKLNLISVWLGCFFTGLAMSQILPFLPLYVEQLGVSGHQSLSIWSGLVFSGTFLVSA
LVSPLWGSLADRKGRKLMLLRASLGMAIVIALQGMVTNVYQLFALRALMGLTSGYIPNAM
ALVASQVPRDKSGWALGTLSTGQISGVIAGPLLGGLMADHLGLRVVFFVTAGLMFVSFLI
TLFLIKERRIEVKKADRLSGKAVFQSLPYPALIVTLFISTLMIQLANSSISPILTLFIKE
LSGDSGNIAFISGMIAAVPGVAALISAPRLGRLGDRIGTARILLAALGLTTLLFAIMAWV
ETPLQLGILRFLLGFADGALMPAVQTLLLKYSSDQVTGRIFGYNQSFMYLGNVVGPLIGS
GVSALLGFRWVFAVTAVLVLLNCLQVRRQFKQVENGRR