Protein Info for IAI46_11975 in Serratia liquefaciens MT49

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details PF00892: EamA" amino acids 3 to 135 (133 residues), 48.1 bits, see alignment E=7e-17 amino acids 167 to 286 (120 residues), 56 bits, see alignment E=2.5e-19

Best Hits

KEGG orthology group: None (inferred from 95% identity to srr:SerAS9_2294)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>IAI46_11975 DMT family transporter (Serratia liquefaciens MT49)
MNVLLYLAVVLIWGTTWIAITLQQEGPVAIPVSISYRFVVSAVVMLVILLLARRLRRIAL
RDHLFCVLQGCCVFGFNFYCFYHAAAYISSGLESVIFSMAVLFNAVNGIIFFRQRPSPNL
LPAAVLGLTGIVALFWQDLVATQMAPDLLKGIGLSALGTYGFSLGNMISSRHQRHGLDIL
STNTYAMSYGAILMALIALAQGASFQIEFSTRYIGSLLYLAIFGSVIAFAAYFSLLGRIG
AGAAAYSTLLFPLVALTISTLYEGYQWHTNAVIGLCLILLGNLVMFAKPGRFAGLWRRPV
A