Protein Info for IAI46_11900 in Serratia liquefaciens MT49

Annotation: PTS glucose transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 transmembrane" amino acids 102 to 129 (28 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 355 to 371 (17 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details amino acids 424 to 446 (23 residues), see Phobius details TIGR01995: PTS system, beta-glucoside-specific IIABC component" amino acids 3 to 611 (609 residues), 697.9 bits, see alignment E=1.3e-213 PF00367: PTS_EIIB" amino acids 9 to 40 (32 residues), 49.5 bits, see alignment (E = 3.3e-17) PF02378: PTS_EIIC" amino acids 108 to 388 (281 residues), 124.5 bits, see alignment E=7.7e-40 PF00358: PTS_EIIA_1" amino acids 468 to 592 (125 residues), 150.7 bits, see alignment E=2.5e-48 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 469 to 589 (121 residues), 132.3 bits, see alignment E=8.9e-43

Best Hits

KEGG orthology group: K02755, PTS system, beta-glucosides-specific IIA component [EC: 2.7.1.69] K02756, PTS system, beta-glucosides-specific IIB component [EC: 2.7.1.69] K02757, PTS system, beta-glucosides-specific IIC component (inferred from 91% identity to spe:Spro_2323)

Predicted SEED Role

"PTS system, beta-glucoside-specific IIB component (EC 2.7.1.69) / PTS system, beta-glucoside-specific IIC component / PTS system, beta-glucoside-specific IIA component" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (621 amino acids)

>IAI46_11900 PTS glucose transporter subunit IIA (Serratia liquefaciens MT49)
MDYKQLGLEILLQVGGKDNVSKLTHCATRLRMEFNDDSKVQAKAIESLPGVISVVERGGQ
FQIVVGNNVQQTFRAMQKEIGDLSGRQSEKNSQARGGVISQIISVISTTFTPVIPAITGA
GMIKALLAILKLTGVIDAASPTYHLLDTIADAAFFFLPVLLAYGAAIKFECNPILAMTIA
GALLHPNLAQMLAAGTVIDFVGIPVRLADYAGSVLPIIFTVWLMSYIERFAEKVSPTMIK
FFTKPMIILLVTAPLALVVVGPFGIFLNDLVAAGAAIVDGKASWLIPMLMGGLQPFLVIT
GTAWAMTPIATGQLSKNGFEMINGPGMLASNIAQGAATLCVAFRTKNKNLRQLASSAGFT
ALLGITEPSLYGVTLKLRKPLIAAMIGGGCAGIYAGLSGLVRYAFVSPGLAALPAFIGEN
PMNIVHALITCAIAIVVTFALTWMLGFDDPVEETGSGGSEAVSGAEQQIFSPLNGQLVAL
AQVNDDVFSQGLLGQGVAIRPQEGVLRAPLTGEVVTFLPSMHAVGIKGDNGVELLVHIGI
DTVNLAGQHFTSDLKVGDRVQVGDELVRFDLAAIVGLGYDITTPVLVVNSEAFPQLNCRQ
PGAVDFGQPIITLNNAQQEQA