Protein Info for IAI46_11865 in Serratia liquefaciens MT49

Annotation: peptidase domain-containing ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 transmembrane" amino acids 169 to 189 (21 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 298 to 325 (28 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details PF03412: Peptidase_C39" amino acids 15 to 142 (128 residues), 115 bits, see alignment E=3.5e-37 PF00664: ABC_membrane" amino acids 173 to 437 (265 residues), 136.7 bits, see alignment E=1.9e-43 PF00005: ABC_tran" amino acids 512 to 661 (150 residues), 115.2 bits, see alignment E=5.4e-37

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 89% identity to spe:Spro_2317)

Predicted SEED Role

"Colicin V secretion ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (711 amino acids)

>IAI46_11865 peptidase domain-containing ABC transporter (Serratia liquefaciens MT49)
MDVTEGLNWGWRKRLPLIRQTESAECGVACLAMIAGWYGHRVDLPTLRAQFKVSQLGMTF
SQLIACAERLHLSGRAVQLELEELHLLSLPCILYWDMNHFTMLKRVRGQTLELHDPARGL
VKMSLQEANRHFTGVAMELTPTHQFVVKDRRKKIRLRELIGKTQGLKAALARIFCFALAL
EVFALIGPLINQLVIDEVLVALDASLLTLIVIAMLLMAATQTLLELARQWATLTMAVNFN
MQWTANVFHHLLRLPINWFESRNMGDISAKFDAVDTIQDTLTTTLLEAFLDVLSVLGTLT
MMFFYSVKLTLVALAAAMVYGLLRLFWFSTLRKAADDSWVAGTQESSHFLESLRGVLSLR
VNGALTPRETVWRNLNVARRNAELRESKLMMVYGIMQTVIGSLVGAAVLWLGAGAVLAGQ
FSVGMLVAYMSFQGRFSASISGLIDKAVAYKMLDVYNQRLADIVLTAREDAAAQAAGNST
LLLSASAWPQDRPALSLEQVSFHYAGTESEILSQVSLDIMPGEVVALVGASGSGKTTLAK
LVLGLYSPTAGMIRTLGIEHRQGDYSQVRQHIGVVLQEDQLFRGSIAENLSFFTPRVDQD
KLVECARLAQLDQDIDNLPMGYQTLIGEMGGTLSAGQKQRLLLARALYKKPRLLILDEAT
SHLDVNNEMLISHTLRQLGLPILLIAHRPETIASADRVVELAAGRLHRRKG